General Information

  • ID:  hor005607
  • Uniprot ID:  C0HKS3
  • Protein name:  DAGWWIPQHGHHALAGVR-amide
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  insulin family
  • Source:  animal
  • Expression:  DAGWWIPQHGHHALAGVR-amide: Expressed in corpora cardiaca (CC), corpora allata (CA), antennal lobe (AL) and gnathal ganglion (GNG) (at protein level). Expression in CC and CA detected in most animals, in AL and GNG in few animals (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DAGWWIPQHGHHALAGVR
  • Length:  18(47-64)
  • Propeptide:  MKSFMVFVLIFACFSCYYAQESTNFYCGRTLSRALAVLCYGAESKRDAGWWIPQHGHHALAGVRGKRGPVDECCEKACSIQELMTYC
  • Signal peptide:  MKSFMVFVLIFACFSCYYA
  • Modification:  T18 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20394-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005607_AF2.pdbhor005607_ESM.pdb

Physical Information

Mass: 231167 Formula: C92H130N30O22
Absent amino acids: CEFKMNSTY Common amino acids: AGH
pI: 7.81 Basic residues: 4
Polar residues: 3 Hydrophobic residues: 8
Hydrophobicity: -43.33 Boman Index: -1637
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 76.11
Instability Index: 1963.89 Extinction Coefficient cystines: 11000
Absorbance 280nm: 647.06

Literature

  • PubMed ID:  29466015
  • Title:  Mating-Induced Differential Peptidomics of Neuropeptides and Protein Hormones in Agrotis Ipsilon Moths